PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000848-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 471aa    MW: 52275.4 Da    PI: 6.6394
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000848-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-16163208147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
    NNU_000848-RA 163 RGHWRPAEDTKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 208
                      899*****************************.***********996 PP

2Myb_DNA-binding54.33.1e-17215258146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+++l  a++++G++ W+ Iar ++ gRt++ +k++w+ 
    NNU_000848-RA 215 RRAFTEEEEDRLMAAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 258
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.201158209IPR017930Myb domain
SMARTSM007173.3E-14162211IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-28163256IPR009057Homeodomain-like
PfamPF002498.4E-16163208IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-25164216IPR009057Homeodomain-like
CDDcd001674.88E-13166207No hitNo description
PROSITE profilePS5129426.817210264IPR017930Myb domain
SMARTSM007175.1E-14214262IPR001005SANT/Myb domain
PfamPF002495.7E-14215257IPR001005SANT/Myb domain
CDDcd001674.08E-11217257No hitNo description
Gene3DG3DSA:1.10.10.602.0E-20217263IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MKLTLQQFSK IVCHQENDGM TKDYNMYAPD LSTGFSSYST TTTTSSSSPR SSSMGVFADL  60
GSLSINPKYA SQESYDGKSS QKDNRRGGWA FPFMGNCTGS SLEDPHNNEG DDSKGSESSD  120
GFGENNAVMQ DNNNKHKFNE ENPNADSVNG KEIDCGQSKL CARGHWRPAE DTKLKELVAL  180
YGPQNWNLIA EKLEGRSGKS CRLRWFNQLD PRINRRAFTE EEEDRLMAAH RLYGNKWAMI  240
ARLFPGRTDN AVKNHWHVIM ARKYREQSNA YRRRKLSQTV SRRLEEPANF VCRDTSTRTD  300
SNSLNLCNGD FNNHSAFPFG AIYCGGIAGS NGLANMTNGG EDSVSCSRDL LLGSSSRKIF  360
PPHGAYCSDQ VPFDFFSGPN NMTSFYGQNR PWDRASDDST LTGFYTSHPP MMMPMQQSNQ  420
YQLSCFSDST TSTSHVSVTE PSSSAADNNP ASHFESTISP PFIDFLGVGA T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-331632637107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257780.10.0PREDICTED: uncharacterized protein LOC104597747
TrEMBLF6HPQ31e-173F6HPQ3_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g02600.t011e-172(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.16e-76myb domain protein 105